.. DO NOT EDIT. .. THIS FILE WAS AUTOMATICALLY GENERATED BY SPHINX-GALLERY. .. TO MAKE CHANGES, EDIT THE SOURCE PYTHON FILE: .. "examples/gallery/sequence/homology/plotepiscan.py" .. LINE NUMBERS ARE GIVEN BELOW. .. only:: html .. note:: :class: sphx-glr-download-link-note :ref:`Go to the end ` to download the full example code. .. rst-class:: sphx-glr-example-title .. _sphx_glr_examples_gallery_sequence_homology_plotepiscan.py: Plot epitope mapping data onto protein sequence alignments ========================================================== Peptide arrays can be used as a high-throughput platform for screening biological interactions. Typical screenings involve the immobilization of diverse peptides on a solid surface to study their interactions with various target molecules. Specifically, arrays of peptides with overlapping sequences can be used to identify the epitope of antibodies on a protein antigen at amino acid level. General scannings for molecular recognition using peptide arrays are particlularly useful for epitope identification on monoclonal antibodies. This example visualizes the data from two epitope mapping studies, using a color coded sequence alignment representation of the antigens screened. The scannings interrogated a monoclonal antibody (MAb) against two arrays of overlaping peptides :footcite:`Iyamu2023`. The files containing peptide array data can be downloaded :download:`here ` and :download:`here `. The antigens screened span the extracellular domain of VAR2CSA, a virulence factor of *Plasmodiun falciparum* for the strains FCR3 (residues 1-2659) and NF54 (residues 1-2652). The sequence of the two domains can be downloaded :download:`here `. First, we generate a sequence aligment of the two VAR2CSA strains: .. GENERATED FROM PYTHON SOURCE LINES 30-64 .. code-block:: Python # Code source: Daniel Ferrer-Vinals # License: BSD 3 clause import matplotlib as mpl import matplotlib.pyplot as plt import numpy as np import pandas as pd import biotite.sequence as seq import biotite.sequence.align as align import biotite.sequence.graphics as graphics import biotite.sequence.io.fasta as fasta # Path to the data files array_seq_path = "../../../download/Array_Seq.txt" fasta_file = fasta.FastaFile.read(array_seq_path) # Parse protein sequences of FCR3 and NF54 for name, sequence in fasta_file.items(): if "AAQ73926" in name: fcr3_seq = seq.ProteinSequence(sequence) elif "EWC87419" in name: nf54_seq = seq.ProteinSequence(sequence) # Get BLOSUM62 matrix matrix = align.SubstitutionMatrix.std_protein_matrix() # Perform pairwise sequence alignment alignments = align.align_optimal( fcr3_seq, nf54_seq, matrix, gap_penalty=(-10, -1), terminal_penalty=False ) alignment = alignments[0] print(alignment) .. rst-class:: sphx-glr-script-out .. code-block:: none GSGSGSGMDSTSTIANKIEEYLGAKSDDSKIDELLKADPSEVEYYRSGGDGDYLKNNICKITVNHSDSGK GSGSGSGMDKSS-IANKIEAYLGAKSDDSKIDQSLKADPSEVQYYGSGGDGYYLRKNICKITVNHSDSGT YDPCEKKLPPYDDNDQWKCQQNSSDGSGKPENICVPPRRERLCTYNLENLKFDKIRDNNAFLADVLLTAR NDPCDRIPPPYGDNDQWKCAIILSKVSEKPENVFVPPRRQRMCINNLEKLNVDKIRDKHAFLADVLLTAR NEGEKIVQNHPDTNSSNVCNALERSFADLADIIRGTDQWKGTNSNLEKNLKQMFAKIRENDKVLQDKYPK NEGERIVQNHPDTNSSNVCNALERSFADIADIIRGTDLWKGTNSNLEQNLKQMFAKIRENDKVLQDKYPK DQKYTKLREAWWNANRQKVWEVITCGARSNDLLIKRGWRTSGKSDRKKNFELCRKCGHYEKEVPTKLDYV DQNYRKLREDWWNANRQKVWEVITCGARSNDLLIKRGWRTSGKSNGDNKLELCRKCGHYEEKVPTKLDYV PQFLRWLTEWIEDFYREKQNLIDDMERHREECTREDHKSKEGTSYCSTCKDKCKKYCECVKKWKTEWENQ PQFLRWLTEWIEDFYREKQNLIDDMERHREECTSEDHKSKEGTSYCSTCKDKCKKYCECVKKWKSEWENQ ENKYKDLYEQNKNKTSQKNTSRYDDYVKDFFEKLEANYSSLENYIKGDPYFAEYATKLSFILNPSDANNP KNKYTELYQQNKNETSQKNTSRYDDYVKDFFKKLEANYSSLENYIKGDPYFAEYATKLSFILNSSDANNP SGETANHNDEACNCNESGISSVGQAQTSGPSSNKTCITHSSIKTNKKKECKDVKLGVRENDKDLKICVIE SEKIQKNNDEVCNCNESGIASVEQEQISDPSSNKTCITHSSIKANKKKVCKHVKLGVRENDKDLRVCVIE DTSLSGVDNCCCQDLLGILQENCSDNKRGSSSNDSCDNKNQDECQKKLEKVFASLTNGYKCDKCKSGTSR HTSLSGVENCCCQDFLRILQENCSDNKSGSSSNGSCNNKNQEACEKNLEKVLASLTNCYKCDKCKSEQSK -SKKKWIWKKSSGNEEGLQEEYANTIGLPPRTQSLYLGN-LPKLENVCEDVKDINFDTKEKFLAGCLIVS KNNKNWIWKKSSGKEGGLQKEYANTIGLPPRTQSLCLVVCLDEKGKKTQELKNIR--TNSELLKEWIIAA FHEGKNLKKRYPQNKNSGNKENLCKALEYSFADYGDLIKGTSIWDNEYTKDLELNLQNNFGKLFGKYIKK FHEGKNLKPSH-EKKNDDNGKKLCKALEYSFADYGDLIKGTSIWDNEYTKDLELNLQKIFGKLFRKYIKK NNTAEQDTSYSSLDELRESWWNTNKKYIWTAMKHGAEMNITTCNADGSVTGSGSSCDDIPTIDLIPQYLR NNTAEQDTSYSSLDELRESWWNTNKKYIWLAMKHGAGMNSTTCCGDGSVTGSGSSCDDIPTIDLIPQYLR FLQEWVENFCEQRQAKVKDVITNCKSCKESGNKCKTECKTKCKDECEKYKKFIEACGTAGGGIGTAGSPW FLQEWVEHFCKQRQEKVKPVIENCKSCKESGGTCNGECKTECKNKCEVYKKFIEDCK---GGDGTAGSSW SKRWDQIYKRYSKHIEDAKRNRKAGTKNCGTSSTTNAAASTDENKCVQSDIDSFFKHLIDIGLTTPSSYL VKRWDQIYKRYSKYIEDAKRNRKAGTKNCGPSSTTNAA----ENKCVQSDIDSFFKHLIDIGLTTPSSYL SNVLDDNICGADKAPWTTYTTYTTTEKCNKERDKSKSQSSDTLVVVNVPSPLGNTPYRYKYACQCKIPTN SIVLDDNICGADKAPWTTYTTYTTTEKCNKETDKSKLQQCNTAVVVNVPSPLGNTPHGYKYACQCKIPTN EETCDDRKEYMNQWSCGSARTMKRGYKNDNYELCKYNGVDVKPTTVRSNSSKLDGNDVTFFNLFEQWNKE EETCDDRKEYMNQWSCGSARTMKRGYKNDNYELCKYNGVDVKPTTVRSNSSKLDDKDVTFFNLFEQWNKE IQYQIEQYMTNANISCIDEKEVLDSVSDEGT-PKVRGGYEDGRNNNTDQGTNCKEKCKCYKLWIEKINDQ IQYQIEQYMTNTKISCNNEKNVLSRVSDEAAQPKFSDNERD-RNSITHEDKNCKEKCKCYSLWIEKINDQ WGKQKDNYNKFRSKQIYDANKGSQNKKVVSLSNFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKC WDKQKDNYNKFQRKQIYDANKGSQNKKVVSLSNFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKC GNNSAHGEEIFNEKLKNAEKKCKENESTDTNINKSETSCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWI GNDSGDGETIFSEKLNNAEKKCKENESTNNKMKSSETSCDCSEPIYIRGCQPKIYDGKIFPGKGGEKQWI CKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTA CKDTIIHGDTNGACIPPRTQNLCVGELWDKRYGGRSNIKNDTKESLKQKIKNAIQKETELLYEYHDKGTA IISKNDKKGQKGK----NDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQ IISRNPMKGQKEKEEKNNDSNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEYIGKLQEDIKKIIEKGTTK QKDKIGGVGSSTENVNAWWKGIEREMWDAVRCAITKINKKNN-NSIFNGDECGVSPPTGNDEDQSVSWFK QNGKT--VGSGAENVNAWWKGIEGEMWDAVRCAITKINKKQKKNGTFSIDECGIFPPTGNDEDQSVSWFK EWGEQFCIERLRYEQNIREACTINGKNEKKCINSKSGQGDKIQGACKRKCEKYKKYISEKKQEWDKQKTK EWSEQFCIERLQYEKNIRDACTNNG------------QGDKIQGDCKRKCEEYKKYISEKKQEWDKQKTK YENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCEQVKYYKYNNAEKKNNKSL YENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCEQVKYYEYNNAEKKNNKSL CYEKDNDMTWSKKYIKKLENGRSLEGVYVPPRRQQLCLYELFPIIIKNEEGMEKAKEELLETLQIVAERE CHEKGNDRTWSKKYIKKLENGRTLEGVYVPPRRQQLCLYELFPIIIKNKNDITNAKKELLETLQIVAERE AYYLWKQYNPTGKGIDDANKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNEIFGSSDTNDIDTK AYYLWKQYHAHNDTTYLAHKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNEIFDSSNKNDIETK RARTDWWENETIT-------NGTDRKTIRQLVWDAMQSGVRYAVEEK------NENFPLCMGVEHIGIAK RARTDWWENEAIAVPNITGANKSDPKTIRQLVWDAMQSGVRKAIDEEKEKKKPNENFPPCMGVQHIGIAK PQFIRWLEEWTNEFCEKYTKYFEDMKSKCDPPKRADTCGDNSNIECKKACANYTNWLNPKRIEWNGMSNY PQFIRWLEEWTNEFCEKYTKYFEDMKSNCNLRKGADDCDDNSNIECKKACANYTNWLNPKRIEWNGMSNY YNKIYRKSNKESEGGKDYSMIMAPTVIDYLNKRCHGEINGNYICCSCKNIGAYNTTSGTVNKKLQKKETE YNKIYRKSNKESEDGKDYSMIMEPTVIDYLNKRCNGEINGNYICCSCKNIGE-NSTSGTVNKKLQKKETQ CEEEKGPLDLMNEVLNKMDKKYSAHKMKCTEVYLEHVEEQLNEIDNAIKDYKLYPLDRCFDDQTKMKVCD CEDNKGPLDLMNKVLNKMDPKYSEHKMKCTEVYLEHVEEQLKEIDNAIKDYKLYPLDRCFDDKSKMKVCD LIADAIGCKDKTKLDELDEWNDMDLRGTYNKHKGVLIPPRRRQLCFSRIVRGPANLRSLNEFKEEILKGA LIGDAIGCKHKTKLDELDEWNDVDMRDPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLKEFKEEILKGA QSEGKFLGNYYKEHKDKEKALEAMKNSFYDYEDIIKGTDMLTNIEFKDIKIKLDRLLEKETNNTKKAEDW QSEGKFLGNYYNEDKDKEKALEAMKNSFYDYEYIIKGSDMLTNIQFKDIKRKLDRLLEKETNNTEKVDDW WKTNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTETPPQFLRWIKEWGTNVCIQKQEHKEYVKSKCSNVT WETNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTETPPQFLRWIKEWGTNVCIQKEEHKEYVKSKCSNVT NLGAQASESNNCTSEIKKYQEWSRKRSIRWETISKRYKKYKRMD----ILKDVKEPDANT-----YLREH NLGAQESESKNCTSEIKKYQEWSRKRSIQWEAISEGYKKYKGMDEFKNTFKNIKEPDANEPNANEYLKKH CSKCPCGFNDMEEMNNNEDNEKEAFKQIKEQVKIPAELEDVIYRIKHHEYDKGNDYICNKYKNIHDRMKK CSKCPCGFNDMQEITKYTNIGNEAFKQIKEQVDIPAELEDVIYRLKHHEYDKGNDYICNKYKNINVNMKK NNGNFVTDNFVKKSWEISNGVLIPPRRKNLFLYIDPSKICEYKKDPKLFKDFIYWSAFTEVERLKKAYGG NNDDTWTD-LVKNSSDINKGVLLPPRRKNLFLKIDESDICKYKRDPKLFKDFIYSSAISEVERLKKVYGE ARAKVVHAMKYSFTDIGSIIKGDDMMEKNSSDKIGKILGDTDGQNEKRKKWWDMNKYHIWESMLCGYREA AKTKVVHAMKYSFADIGSIIKGDDMMENNSSDKIGKILGDGVGQNEKRKKWWDMNKYHIWESMLCGYKHA EGDTETNEN--CRFPDIESVPQFLRWFQEWSENFCDRRQKLYDKLNSECISAEC--TNGSVDNSKCTHAC YGNISENDRKMLDIPNNDDEHQFLRWFQEWTENFCTKRNELYENMVTACNSAKCNTSNGSVDKKECTEAC VNYKNYILTKKTEYEIQTNKYDNEFKNKNSNDKDAPDYLKEKCNDNKCECLNKHIDDKNKTWKNPYETLE KNYSNFILIKKKEYQSLNSQYDMNYKETKAEKKESPEYFKDKCN-GECSCLSEYFKDETR-WKNPYETLD DT-FKSKCDCPKPLPSPIKPDDLPPQADEPFDPTILQTTIPGSGSGSG DTEVKNNCMCKPP----------PPASNNTSD--ILQKTIPGSGSGSG .. GENERATED FROM PYTHON SOURCE LINES 65-81 Epitope mapping data -------------------- This study used arrays of overlaping peptides to achive high acurracy in mapping the epitope. Both FCR3 and NF54 arrays, consisted of 20-mer peptides with an overlap of 19 and 18 amino acids respectively. Arbitrary units (AU) of fluorescence intensity quantified the antibody recognition for each peptide. Our goal is to decorate the aligment, with the fluorescence intensity scores of each peptide in the arrays. We used a color code from red to white for high to low intensity, respectively. The background color of the symbols on the aligment corresponds to the score for the 20th amino acid at the end of the peptide. Lets create a function that maps the peptide score to the 20th residue of the peptide: .. GENERATED FROM PYTHON SOURCE LINES 81-118 .. code-block:: Python def read_scan(filename, pep_len=20, score_res=20): if type(pep_len) is not int: raise TypeError("pep_len : only integers are allowed") elif type(score_res) is not int: raise TypeError("score_res : only integers are allowed") elif pep_len < score_res: raise Exception("score_res can't be higher than pep_len") elif pep_len != 20 or score_res != 20: s = (score_res) - pep_len - 1 else: s = -1 df = pd.read_csv(filename) scor_res = df["Seq"].str[s] df["s_res"] = scor_res return df # Load epitope scan data fcr3_file_path = "../../../download/FCR3_10ug.csv" nf54_file_path = "../../../download/NF54_10ug.csv" # Define the score residues on the arrays files = [fcr3_file_path, nf54_file_path] d = 0 for f in files: if f == files[0]: ag1_scan = read_scan(files[d], 20, 20) elif f == files[1]: ag2_scan = read_scan(files[d], 20, 20) d = d + 1 ag1_scan.head(5) .. GENERATED FROM PYTHON SOURCE LINES 119-134 The microarrays contained each peptide printed in duplicated spots. We need to combine the values of those experimental replicates into a unique score for each peptide. Typically, this unique value could come from the geometric mean between replicates that do not deviate wildly. If the average deviation between replicates is high, one can assumme that experimental errors should result in a lower score at a given spot. It is easy to imagine that imperfections on the printing of the spot, will rather decrease and not increase, the antibody recognition, in which case the the peptide signal is better represented by the higher score replicate. Now lets write a function to combine the scores adding the flexibility to choose cases for those criterias exposed above. We will flag with 0 or 1 every peptide entry on the arrays: 1 if the deviation between replicates is higher than 40%, otherwise 0. .. GENERATED FROM PYTHON SOURCE LINES 134-168 .. code-block:: Python def combine_scores(dataframe, combine="max", flag_noisy=True): df = dataframe # mean df["ave"] = df.iloc[:, [1, 2]].mean(axis=1) # mean deviation df["avedev"] = ((df.r1 - df.ave).abs() + (df.r2 - df.ave).abs()) / 2 # percent deviation between replicates df["dev_ratio"] = df.apply( lambda x: 0 if x.avedev == 0 else x.avedev / x.ave, axis=1 ) # signal value: if combine == "max": df["comb_signal"] = df.apply( lambda x: max(x.r1, x.r2) if x.dev_ratio >= 0.4 else x.ave, axis=1 ) elif combine == "mean": df["comb_signal"] = df.apply( lambda x: x.ave if x.dev_ratio <= 0.4 else 0, axis=1 ) if flag_noisy: df["flag"] = df.apply(lambda x: 0 if x.dev_ratio <= 0.4 else 1, axis=1) return df # Make the corresponding signal equal the replicate with the higest # score value. dfa = combine_scores(ag1_scan, combine="max", flag_noisy=True) dfb = combine_scores(ag2_scan, combine="max", flag_noisy=True) dfa.head(5) .. GENERATED FROM PYTHON SOURCE LINES 169-173 Many molecular recognition screening campaings e.g. epitope mapping screenings follow a long-tailed data distribution. To properly represent such distribution one can normalize the date using linear or non-linear transformations on the combined score data. .. GENERATED FROM PYTHON SOURCE LINES 173-188 .. code-block:: Python def data_transform(dataframe, threshold=0): df = dataframe # Option to set a "threshold" for the signal scores. t = threshold df["cubic"] = df.apply(lambda x: np.cbrt(max(0, x.comb_signal - t)), axis=1) df["signal_plot"] = df.apply(lambda x: x.cubic / df["cubic"].max(), axis=1) # Normalize, using the power law with cubic exponent. No threshold data_transform(dfa, threshold=0) data_transform(dfb, threshold=0) dfa.head(5) .. GENERATED FROM PYTHON SOURCE LINES 189-197 Convert score residues from the epitope scan to alignment-like gapped sequences ------------------------------------------------------------------------------- So far, we have the peptide score data combined, normalized, and mapped to a residue for each peptide. Next, using the alignment trace as a template, we will match the signal intensities associated to the score residues, to the position of each symbol on the alignment, considering the gaps. .. GENERATED FROM PYTHON SOURCE LINES 197-327 .. code-block:: Python # Get the trace for each sequence on the alignment: trace_a = align.get_symbols(alignment)[0] trace_b = align.get_symbols(alignment)[1] def gapped_seq(dataframe, seq_trace, p_len, overlap_step=1): """ Generate a gapped sequence that relates peptide score data signal with a template alignment trace. The function returns a list of tuples representing the gapped sequence, where each tuple consists of a residue and its associated signal value. Parameters ---------- dataframe : DataFrame A *Pandas* dataframe containing columns for each peptide score data, and its designated score residue. seq_trace : list The sequence trace obtained from the alignment. p_len : int The length of each overlapping peptide. overlap_step : int, optional The step size for overlapping peptides.Default is 1. Note: ----- The 'gapped' sequence may be shorter than the aligment trace if the alignment results in gaps at either end. Any remaining elements in the trace with 'None' values are filled with tuples: ('None', 0). """ template = seq_trace df = dataframe step = overlap_step gapped = list(zip(df.s_res, df.signal_plot)) lk1 = df["s_res"].values.tolist() plen = p_len # peptide length if step == 1: x, b = 0, 0 c = 0 # cyclic counter up to the peptide length :20 p = 0 # peptide counter for b in range(len(lk1)): for a in template[x:]: if c < plen - 1: if a is None: gapped.insert(x, (template[x], 0)) x = x + 1 elif a != lk1[b]: gapped.insert(x, (template[x], 0)) x = x + 1 c = c + 1 elif p == 0: gapped.insert(x, (template[x], 0)) x = x + 1 c = c + 1 else: x = x + 1 c = c + 1 break else: c = 0 # reset the counter p = p + 1 x = x + 1 break elif step == 2: x, b = 0, 0 c = 0 p = 0 for b in range(len(lk1)): for a in template[x:]: if c < plen - 1 and p == 0: if a is None: gapped.insert(x, (template[x], 0)) x = x + 1 else: gapped.insert(x, (template[x], 0)) x = x + 1 c = c + 1 elif p == 0: c = 0 # reset the counter p = p + 1 x = x + 1 break if p != 0: if a is None and c == 0: gapped.insert(x, (template[x], 0)) x = x + 1 elif c % 2 == 0: if a is None: gapped.insert(x, (template[x], 0)) x = x + 1 else: gapped.insert(x, (template[x], 0)) x = x + 1 c = c + 1 elif c % 2 != 0: if a is None: gapped.insert(x, (template[x], 0)) x = x + 1 elif a != lk1[b]: gapped.insert(x, (template[x], 0)) x = x + 1 c = c + 1 else: x = x + 1 c = c + 1 break # For terminal gaps if len(gapped) < len(template) and template[len(gapped) + 1] is None: gapped_tail = [] for n in range(len(template) - len(gapped)): gapped_tail.append(("None", 0)) gapped = gapped + gapped_tail return gapped # Let's use gapped_seq() to build the gapped sequences # FCR3 array, overlap_step: 1 (pep = 20-mer with 19 overlap) gapd_s1 = gapped_seq(dfa, trace_a, 20, 1) # NF54 array, overlap_step: 2 (pep = 20-mer with 18 overlap) gapd_s2 = gapped_seq(dfb, trace_b, 20, 2) # Checkpoint. Both gapped sequences must have the same length. len(gapd_s1) == len(gapd_s2) .. GENERATED FROM PYTHON SOURCE LINES 328-333 Create a signal map ------------------- Now we will generate an object mapping the signal scores from two gapped sequences. .. GENERATED FROM PYTHON SOURCE LINES 333-375 .. code-block:: Python def signal_map( gapped_seq1, gapped_seq2, ): """ Generate a mapping of signal scores from two gapped sequences. This function takes two gapped sequences, `gapped_seq1` and `gapped_seq2`. Each sequence is represented as a list of tuples, with the first element being an amino acid symbol and the second element being a signal score. It extracts the signal scores from each sequence and creates a 2D array with two columns, where the first column contains signal scores from `gapped_seq1` and the second column contains signal scores from `gapped_seq2`. Parameters: ----------- gapped_seq1: list The first gapped sequence. gapped_seq2: list The second gapped sequence. Returns: -------- numpy.ndarray: A 2D numpy array with two columns containing signal scores extracted from `gapped_seq1` and `gapped_seq2` respectively. """ gapd_s1 = gapped_seq1 gapd_s2 = gapped_seq2 fl_score = np.zeros((len(gapd_s1), 2)) for v1 in range(len(gapd_s1)): fl_score[v1, 0] = gapd_s1[v1][1] fl_score[v1, 1] = gapd_s2[v1][1] return fl_score score = signal_map(gapd_s1, gapd_s2) .. GENERATED FROM PYTHON SOURCE LINES 376-390 Sequence alignment decorated with MAb recognition regions --------------------------------------------------------- Now we can plot the sequence alignment using an :class:`ArrayPlotter` instance that higlights sequence recognition regions at the positions of the respective score residue per alignment column. To easily interpret the intensity-decorated alignment we will add a colorbar scaled accordingly. The scale matches the transformation applied to the recognition signal recorded on the score ndarray. Let's build a function to create a custom colorbar object. We will specify the dataframes corresponding to the two antigens screened in this example, the colormap, and the transformation to be represented with the colorbar. .. GENERATED FROM PYTHON SOURCE LINES 390-456 .. code-block:: Python fig = plt.figure(figsize=(8.0, 15)) ax = fig.add_subplot(111) graphics.plot_alignment_array( ax, alignments[0], fl_score=score, labels=["FCR3", "NF54"], show_numbers=True, symbols_per_line=80, show_line_position=True, label_size=10, number_size=10, symbol_size=6, ) # Add the axes where the colorbar will reside: ax2 = fig.add_axes([0.13, 0.07, 0.8, 0.01]) ax2.set_frame_on(False) # Access the colormap of the relevant instace of ArrayPlotter: colormap = graphics.ArrayPlotter(ax2, score).get_cmap() def draw_colorbar(axes, array1, array2, colormap, orient=None, title=None): df1 = array1 df2 = array2 cmp = colormap ax = axes orientation = orient label = title # custom Formtatter for tick labels on the colorbar def fmt(x, pos): a, b = "{:.1e}".format(x).split("e") b = int(b) return r"${}\cdot10^{{{}}}$".format(a, b) vmiA = df1["comb_signal"].min() vmiB = df2["comb_signal"].min() vmxA = df1["comb_signal"].max() vmxB = df2["comb_signal"].max() # The normalization of this colormap needs to be consistent with the # data trasnformtion used earlier on this example. The "cubic" law: norm = mpl.colors.PowerNorm(gamma=0.33, vmin=min(vmiA, vmiB), vmax=max(vmxA, vmxB)) fig = mpl.pyplot.figure() return fig.colorbar( mpl.cm.ScalarMappable(norm=norm, cmap=cmp), cax=ax, orientation=orientation, label=label, format=mpl.ticker.FuncFormatter(fmt), ) # Draw the colorbar cbar = draw_colorbar( ax2, dfa, dfb, colormap, orient="horizontal", title="Fluorescence Intensity [AU]" ) # To improve readability we tilt the ticklabels on the colorbar labels = cbar.ax.get_xticklabels() plt.setp(labels, rotation=45, horizontalalignment="center") plt.show() .. rst-class:: sphx-glr-horizontal * .. image-sg:: /examples/gallery/sequence/homology/images/sphx_glr_plotepiscan_001.png :alt: plotepiscan :srcset: /examples/gallery/sequence/homology/images/sphx_glr_plotepiscan_001.png, /examples/gallery/sequence/homology/images/sphx_glr_plotepiscan_001_2_00x.png 2.00x :class: sphx-glr-multi-img * .. image-sg:: /examples/gallery/sequence/homology/images/sphx_glr_plotepiscan_002.png :alt: plotepiscan :srcset: /examples/gallery/sequence/homology/images/sphx_glr_plotepiscan_002.png, /examples/gallery/sequence/homology/images/sphx_glr_plotepiscan_002_2_00x.png 2.00x :class: sphx-glr-multi-img .. GENERATED FROM PYTHON SOURCE LINES 457-461 References ---------- .. footbibliography:: .. _sphx_glr_download_examples_gallery_sequence_homology_plotepiscan.py: .. only:: html .. container:: sphx-glr-footer sphx-glr-footer-example .. container:: sphx-glr-download sphx-glr-download-jupyter :download:`Download Jupyter notebook: plotepiscan.ipynb ` .. container:: sphx-glr-download sphx-glr-download-python :download:`Download Python source code: plotepiscan.py ` .. container:: sphx-glr-download sphx-glr-download-zip :download:`Download zipped: plotepiscan.zip ` .. only:: html .. rst-class:: sphx-glr-signature `Gallery generated by Sphinx-Gallery `_